Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

     ⌊ Family cis-3-hydroxy-L-proline dehydratase

  ⌊ FunctionalDomain cis-3-hydroxy-L-proline dehydratase (ID 91871)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES PubMed:25608448
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Starkeya novella Taxon ID: 921 502930021 WP_013164997.1 (RefSeq)
Starkeya novella DSM 506 Taxon ID: 639283 296926683 ADH87492.1 (Genbank) URP
Starkeya novella DSM 506 Taxon ID: 639283 857215029 URP

Uniprot

Protein NameAccessionEC Number Identifier
Cis-3-hydroxy-L-proline dehydratase {ECO:0000303|PubMed:25608448} D7A0Y2 C3HPD_STAND (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 367 | Length of Functional Domain: 367

1       10        20        30        40        50        60

MKITGIKAWKVGLPLKEGRYNWSNGNFVEVFDSTVVAVETDAGITGYAECCPLGSAYLPA
YAHGVRAGLEEIGPKVIGLDPTDLNVLNRHMDSVLRGHPYVKAPIDIACWDILGKVSGLP
VYKLLGGAAQEKVALYRAISQEAPEAMARKIAGYKAEGYTKFQLKVGGDADQDIDRIRVT
REILDATDTLVADANTGWTRAEAARIAAEVGDLDVYIEQPCPTYEECLSVRARTARPFVL
DEVIDGVGTLMKALADDAMDIINLKISKVGGLTKARLMRDICVASGTPMTIEDTWGGDIV
TATIAHLARSTPEEFSFSATDFNSYGTVDIAKGAPKRVNGFMTASDAPGLGIEPIFEVLG
EPVVVIG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
193 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
218 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
241 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
165 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:11747448
193 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
218 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
241 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
Family CAR This EFD conserves 5/5 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
165 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant IME PubMed:25608448
193 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
218 Glu (E) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
241 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
265 Lys (K) side chain None -- IME PubMed:25608448

Catalyzed Reaction

cis-3-Hydroxy-L-proline dehydratase

+
cis-3-hydroxy-L-proline zwitterion
60041		 1-pyrroline-2-carboxylic acid zwitterion
39785		 water
15377

EC: 4.2.1.- | IntEnz: 4.2.1.- | Kegg: 4.2.1.- | BioCyc: 4.2.1.- | BRENDA: 4.2.1.- |

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 2:44 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
Aug. 10, 2015, 3:09 a.m. update curation agent setDomainBoundaries.py sbrown
update name uncharacterized muconate cycloisomerase subgroup sequence cis-3-hydroxy-L-proline dehydratase
update superfamily assignment evidence code IEA ISS
Aug. 10, 2015, 3:09 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 364 367
EC number assigned by UniProtKB accession ID.