Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 9028)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | IGS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 543 | 447178342 | WP_001255598.1 (RefSeq) | |
| Shigella boydii Taxon ID: 621 | 827430821 | AKI67380.1 (Genbank) | URP |
| Escherichia coli Taxon ID: 562 | 763500670 | KIZ69549.1 (Genbank) | URP |
| Shigella boydii 4444-74 Taxon ID: 766140 | 391278178 | EIQ36895.1 (Genbank) | URP |
| Shigella boydii Sb227 Taxon ID: 300268 | 81246154 | ABB66862.1 (Genbank) | URP |
| Shigella boydii Sb227 Taxon ID: 300268 | 123559157 | URP | |
| obsolete GIs = 420353641, 82544743 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| o-succinylbenzoate synthase {ECO:0000255|HAMAP-Rule:MF_00470} | Q31YJ6 | MENC_SHIBS (Swiss-Prot) |
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELLQMPSIAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALRLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



