Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family N-succinylamino acid racemase 1
⌊ FunctionalDomain N-succinylamino acid racemase (ID 5855)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| n/a | 284827163 | ADB99285.1 (Genbank) | |
| Deinococcus radiodurans Taxon ID: 1299 | 56554698 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554697 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554696 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554695 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554662 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554661 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554660 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 56554659 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 55669590 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 55669589 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 55669588 | ||
| Deinococcus radiodurans Taxon ID: 1299 | 55669587 | ||
| Show All | |||
Length of Enzyme (full-length): 375 | Length of Functional Domain: 370
MAHTGRMFKIEAAEIVVARLPLKFRFETSFGVQTHKVVPLLILHGEGVQGVAEGTMEARP
MYREETIAGALDLLRGTFLPAILGQTFANPEAVSDALGSYRGNRMARAMVEMAAWDLWAR
TLGVPLGTLLGGHKEQVEVGVSLGIQADEQATVDLVRRHVEQGYRRIKLKIKPGWDVQPV
RATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLTYIEQPLAWDDLVDHAELARRIRT
PLCLDESVASASDARKALALGAGGVINLKVARVGGHAESRRVHDVAQSFGAPVWCGGMLE
SGIGRAHNIHLSTLSNFRLPGDTSSASRYWERDLIQEPLEAVDGLMPVPQGPGTGVTLDR
EFLATVTEAQEEHRA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.






