Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 455075)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 486163847 | WP_001527355.1 (RefSeq) | URP |
| Escherichia coli Taxon ID: 562 | 767817367 | KJG98061.1 (Genbank) | URP |
| Escherichia coli HVH 108 (4-6924867) Taxon ID: 1281044 | 556156956 | ESP45060.1 (Genbank) | URP |
| Escherichia coli KTE28 Taxon ID: 1169347 | 430930076 | ELC50585.1 (Genbank) | URP |
| obsolete GI = 432407317 | |||
| Show All | |||
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPLDAGVVLRDRRLKTRDGLYVCLCEGEREGWGEISPLPGFSQESWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVKAAHALGLTAVISSSIESSLGLMQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSPLPLVDVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



