Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

     ⌊ Family 4R-hydroxyproline betaine 2-epimerase

  ⌊ FunctionalDomain 4R-hydroxyproline betaine 2-epimerase (ID 449316)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Pelagibaca bermudensis HTCC2601 Taxon ID: 314265 408536077 URP
Pelagibaca bermudensis HTCC2601 Taxon ID: 314265 408536076 URP
Pelagibaca bermudensis HTCC2601 Taxon ID: 314265 408536075 URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
4-hydroxyproline betaine 2-epimerase Q0FPQ4 HPBD_PELBH (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 376 | Length of Functional Domain: 367

1       10        20        30        40        50        60

MAHHHHHHSLKIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCP
VGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLW
GKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEI
DIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIR
PLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTC
DDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGL
GLTIDPERFGPPLFSA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
202 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
227 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
250 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
172 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:11747448
202 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
227 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
250 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
172 Lys (K) side chain None -- ISS PubMed:24056934
202 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:24056934
227 Glu (E) side chain Metal binding ligand metal ligand -- binding ICS PubMed:24056934
250 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:24056934
274 Lys (K) side chain None -- ISS PubMed:24056934
301 Asp (D) side chain Interacts with betaine substrate binding -- binding ICS PubMed:24056934
329 Trp (W) side chain Forms pi-cation interaction with betaine electrostatic stabiliser -- spectator ICS PubMed:24056934

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4H2H Crystal Structure Of An Enolase (Mandalate Racemase Subgroup, Target Efi-502101) From Pelagibaca Bermudensis Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine (Betonicine) Mandelate Racemase/Muconate Lactonizing Enzyme 3 1.7 Magnesium Ion
(4 more ⇓) 		CSA • PDB • PDBSum
2PMQ Crystal Structure Of A Mandelate Racemase/Muconate Lactonizing Enzyme From Roseovarius Sp. Htcc2601 Mandelate Racemase/Muconate Lactonizing Enzyme 3 1.72 Selenomethionine • Magnesium Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 2:55 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
Aug. 10, 2015, 3:16 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
update domain end position 371 376
update name uncharacterized muconate cycloisomerase subgroup sequence 4R-hydroxyproline betaine 2-epimerase
update domain start position 2 10
EC number assigned by UniProtKB accession ID.