Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family N-succinylamino acid racemase 2
⌊ FunctionalDomain N-succinylamino acid racemase 2 (ID 443161)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus cereus Taxon ID: 1396 | 488053524 | WP_002124921.1 (RefSeq) | URP |
| Bacillus cereus BtB2-4 Taxon ID: 1053197 | 402441089 | EJV73062.1 (Genbank) | URP |
| Bacillus cereus VDM022 Taxon ID: 1053247 | 401293237 | EJR98882.1 (Genbank) | URP |
| Bacillus cereus HuA2-4 Taxon ID: 1053203 | 401167591 | EJQ74872.1 (Genbank) | URP |
| Bacillus cereus CER057 Taxon ID: 1053198 | 401160636 | EJQ68012.1 (Genbank) | URP |
| Bacillus cereus CER074 Taxon ID: 1053199 | 401151816 | EJQ59258.1 (Genbank) | URP |
| obsolete GIs = 423515175, 423501859, 423491348, 423485623, 423664357 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | J8D5X0 | J8D5X0_BACCE (TrEMBL) | |
| n/a | J8MYW7 | J8MYW7_BACCE (TrEMBL) | |
| n/a | A0A1X6PUH6 | A0A1X6PUH6_BACMY (TrEMBL) |
Length of Enzyme (full-length): 369 | Length of Functional Domain: 369
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHVLKHTLAPALIGKNPMNIEKIHDMMDNTIYGIPTAKATIDIACFDILGKKLNQPVY
QLIGGRYHEEFPVTHVLSIADPENMAEEAASMIKKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWKNSANTLTALRSLGHLNIDWIEQPVVADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIIKLDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINENTLQE
LTVFQDVVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



