Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup BATS domain containing

  ⌊ cleavage of the Ca-Cb bond in aromatic amino acids

     ⌊ Family 3-methyl-2-indolic acid synthase (NosL)

  ⌊ FunctionalDomain NosL (ID 430927)

Superfamily Assignment Evidence Code(s) ISS PubMed:25196319
Family Assignment Evidence Code CFM PubMed:25196319
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces actuosus Taxon ID: 1885 238626062 ACR48341.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a C6FX51 C6FX51_STRAS (TrEMBL)

Sequence

Length of Enzyme (full-length): 400 | Length of Functional Domain: 395

1       10        20        30        40        50        60

MTQNSQAMTSHAMTGDFVLPELEDVRAEAATVDTRAVLALAEGEEPAESRAAVALALWED
RSIGTAELQAAAEARCGARRPRLHTFVPLYTTNYCDSECKMCSMRKGNHRLDRKFSGRKE
ITEQLEILYHHEGVRGVGFLTGEYEDKHTRLASAFRIGWAIRTALDLGFERVYFNIGSME
QDEIDVLGEWIGREDPVTMCVFQESYDRETYRRFMGKTSVGVPKADFDRRVVSFDRWLDA
GYRYVNPGVLVGLHDDLSAELVSLVAHGDHLRSRGATADLSVPRMRPAMKSRDTTRVGDD
DYLRLMSVVAFTCPEQRLVLTTREPQEFQDVALGLAGVISPGSPDVAPYRAGCEARNDEK
SSQFLVADLRRPRHILGRIEASGTPVDHFVNPAGEASRAV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
99 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
99 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 8/8 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
90 Tyr (Y) side chain Binds tryptophan substrate, possibly a hydrogen atom relay hydrogen relay -- reactant,
substrate binding -- binding 		ICS PubMed:25196319
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
99 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
200 Cys (C) side chain Unknown -- ICS PubMed:25196319
323 Arg (R) side chain Binds tryptophan substrate substrate binding -- binding ICS PubMed:25196319
340 Ser (S) side chain Binds tryptophan substrate substrate binding -- binding ICS PubMed:25196319
363 Gln (Q) side chain Activates Tyr90 activation -- spectator ICS PubMed:25196319

Catalyzed Reaction

3-methyl-2-indolic acid synthase

+ + + +
S-adenosyl-L-methionine zwitterion
59789		 D-tryptophan zwitterion
57719		 3-methyl-2-indolate
85502		 methanimine
38220		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4R34 X-Ray Structure Of The Tryptophan Lyase Nosl With Tryptophan, 5'-Deoxyadenosine And Methionine Bound Nosl 1 1.8 Methionine
(8 more ⇓) 		CSA • PDB • PDBSum
4R33 X-Ray Structure Of The Tryptophan Lyase Nosl With Tryptophan And S-Adenosyl-L-Homocysteine Bound Nosl 1 1.78 S-Adenosyl-L-Homocysteine
(6 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:16 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 391 400
update domain start position 2 6
July 15, 2014, 6:54 a.m. update classification public staff
update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain start position 6 1
update domain start position 1 6
Aug. 15, 2014, 5:37 a.m. update classification staff public
Oct. 16, 2014, 7:30 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family assignment evidence code ISS CFM
EC number assigned by UniProtKB accession ID.