Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup BATS domain containing

  ⌊ cleavage of the Ca-Cb bond in aromatic amino acids

     ⌊ Family 3-methyl-2-indolic acid synthase (NosL)

  ⌊ FunctionalDomain NocL (ID 419733)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:21454624
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Nocardia sp. ATCC 202099 Taxon ID: 930400 312837888 ADR01087.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a E5DUI3 E5DUI3_9NOCA (TrEMBL)

Sequence

Length of Enzyme (full-length): 378 | Length of Functional Domain: 378

1       10        20        30        40        50        60

MRIEAATVDTRAVLALGPDDEPGASRPAVALALWEDESVSTAELVAAAELRCAERTPRLH
TFVPLYTTNHCDSECKMCSMRKGNARMERKFSGRDEIIDQLRILFEHEGVRGVGFLTGEY
EDKYTRLSTAFRIGWAIRTALDMGFERVYFNIGSMEPDEIDVLAEWVRRDDPVTMCVFQE
TYDRDSYSKFMGDTVSGVPKADYDRRVVSFDRWLDKGFRYVNPGVLIGLHLDVAAELVTL
VAHGAHLKDRDAVVDLSVPRMRPAMSSRDSTRIKDDEYMRLMAVLAFTCPEQRLVLTTRE
PQEFQDQAIGLAGVISPGSPDVAPYRADSQARNEETTSQFLVADLRRPRHILGRIEAGGT
KVGHFANPSVGAAVIPIG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
71 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
75 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
78 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
71 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
75 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
78 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 8/8 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
66 Tyr (Y) side chain Binds tryptophan substrate, possibly a hydrogen atom relay hydrogen relay -- reactant,
substrate binding -- binding 		ICS PubMed:25196319
71 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
75 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
78 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
176 Cys (C) side chain Unknown -- ICS PubMed:25196319
299 Arg (R) side chain Binds tryptophan substrate substrate binding -- binding ICS PubMed:25196319
316 Ser (S) side chain Binds tryptophan substrate substrate binding -- binding ICS PubMed:25196319
339 Gln (Q) side chain Activates Tyr90 activation -- spectator ICS PubMed:25196319

Catalyzed Reaction

3-methyl-2-indolic acid synthase

+ + + +
S-adenosyl-L-methionine zwitterion
59789		 D-tryptophan zwitterion
57719		 3-methyl-2-indolate
85502		 methanimine
38220		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:08 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 365 378
update domain start position 41 1
July 15, 2014, 6:52 a.m. update curation agent setDomainBoundaries.py holliday
Oct. 16, 2014, 6:46 a.m. update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.