Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ thioether bond formation requiring one auxiliary iron-sulfur cluster

     ⌊ Family thuricin CD (TrnCD-like)

  ⌊ FunctionalDomain TrnD (ID 395290)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:21760885
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Bacillus cereus 95/8201 Taxon ID: 526979 228658377 EEL14056.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a C2TQ82 C2TQ82_BACCE (TrEMBL)

Sequence

Length of Enzyme (full-length): 408 | Length of Functional Domain: 408

1       10        20        30        40        50        60

MYPYCHLEIGETNSCLYDISSGKMIRVNRENAELLRQCQENVPIESINMDLGILDELIKM
NLGTYYANPQFIEPFFETNDTKNRIFGKNNILRQMFILTSTDCNMNCKHCNTDSTVFRKT
GCKIWPKSINLNALTQSHWRKILEAFYNLHGEELTFIGGEPFLEFDFIKNIVEIAQEVGI
SKFSIFTNGSIINDTILNFLMENKIKVYIQIFEVDENKFKAFTNSDIPSIQIIDNIKKLN
NHHLDLQLRILITRDNDNNVKKIVNTLQKETNVKDIKIEFLYPKPDNSYYSKKYIPLMYD
KKREFSHVNVQKMQFLHQYNPSFFGQITIRRDGKVVPHPMLLTRVIGDLQQDDLFTIINT
EEYQEYSTLNKEKISKCSTCAYKYNCMDDRVIENFATGDLYGMEYCNF
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
103 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
107 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
110 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
103 Cys (C) side chain [4Fe-4S]-AdoMet binding residue cofactor binding -- binding ISS
107 Cys (C) side chain [4Fe-4S]-AdoMet binding residue cofactor binding -- binding ISS
110 Cys (C) side chain [4Fe-4S]-AdoMet binding residue cofactor binding -- binding ISS
377 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
380 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
386 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
103 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
107 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
110 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reactions

thioether cross-link between Cys and Ser

+ + + +
cysteine residue
32460		 L-serine residue
29999		 S-adenosyl-L-methionine zwitterion
59789		 Cys-Ser thioether
132411		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

thioether cross-link between Cys and Thr

+ + + +
cysteine residue
32460		 L-threonine residue
30013		 S-adenosyl-L-methionine zwitterion
59789		 Cys-Thr thioether
132254		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

thioether cross-link between Cys and Ala

+ + + +
cysteine residue
32460		 L-alanine residue
46217		 S-adenosyl-L-methionine zwitterion
59789		 Cys-Ala thioether
132412		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

thioether cross-link between Cys and Tyr

+ + + +
cysteine residue
32460		 L-tyrosine residue
46858		 S-adenosyl-L-methionine zwitterion
59789		 Cys-Tyr thioether
132413		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 5:48 a.m. update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.