Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 389722)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli EC1866 Taxon ID: 1005551 | 408308089 | EKJ25366.1 (Genbank) | URP |
| Escherichia coli EC1846 Taxon ID: 1005541 | 408247186 | EKI69403.1 (Genbank) | URP |
| Escherichia coli NE037 Taxon ID: 1005484 | 408115259 | EKH46725.1 (Genbank) | URP |
| Escherichia coli FDA504 Taxon ID: 1005470 | 408091105 | EKH24339.1 (Genbank) | URP |
| Escherichia coli FDA506 Taxon ID: 1005474 | 408078884 | EKH13012.1 (Genbank) | URP |
| Escherichia coli EC4402 Taxon ID: 1005530 | 390870867 | EIP32326.1 (Genbank) | URP |
| Escherichia coli TW09098 Taxon ID: 1005519 | 390806388 | EIO73300.1 (Genbank) | URP |
| Escherichia coli FRIK1996 Taxon ID: 1005475 | 390641665 | EIN21089.1 (Genbank) | URP |
| obsolete GIs = 425386548, 425330525, 425200597, 425175096, 425163296, 424545223, 424487889, 424091235, 485842363 | |||
| Show All | |||
Length of Enzyme (full-length): 308 | Length of Functional Domain: 308
MDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQSVLLAWVNNWLA
GDCELPQMPSVAFGVSCALAELADTLPQAANYRTAPLCNGDPDDLILKLADMPGEKVAKV
KVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRHRIAFLEEP
CKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAA
HALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVE
VDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



