Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family N-succinylamino acid racemase 2
⌊ FunctionalDomain N-succinylamino acid racemase 2 (ID 38874)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 86661 | 446627123 | WP_000704469.1 (RefSeq) | |
| Bacillus cereus Taxon ID: 1396 | 859535289 | KMP58527.1 (Genbank) | URP |
| Bacillus toyonensis BCT-7112 Taxon ID: 1415784 | 557475145 | AHA08967.1 (Genbank) | URP |
| Bacillus cereus BAG2O-2 Taxon ID: 1053177 | 513459643 | EPF08015.1 (Genbank) | URP |
| Bacillus cereus BAG6O-1 Taxon ID: 1053192 | 402412891 | EJV45243.1 (Genbank) | URP |
| Bacillus cereus BAG1O-2 Taxon ID: 1053168 | 401629174 | EJS47000.1 (Genbank) | URP |
| Bacillus cereus VD148 Taxon ID: 1053237 | 401252229 | EJR58491.1 (Genbank) | URP |
| Bacillus cereus HuB5-5 Taxon ID: 1053212 | 401185934 | EJQ93023.1 (Genbank) | URP |
| Bacillus cereus BAG5O-1 Taxon ID: 1053188 | 401126124 | EJQ33878.1 (Genbank) | URP |
| Bacillus cereus Rock1-3 Taxon ID: 526981 | 228669455 | EEL24871.1 (Genbank) | URP |
| obsolete GIs = 423626468, 423543805, 423467758, 423450336, 423381643, 229113996, 557622525 | |||
| Show All | |||
Length of Enzyme (full-length): 369 | Length of Functional Domain: 369
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSVIVKMETDEGIIGYGEGVADDHVTGESWE
STFHTLKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEDFPVTHVLSIADPEDMAAEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGSDIAIRVDVNQGWKNSANTLTALRSLGHLNIDWIEQPVVADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIIKLDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLQE
LTVFQDVVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



