Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup organic radical-activating enzymes

  ⌊ activating enzymes, group 1

     ⌊ Family anaerobic ribonucleoside-triphosphate reductase activase

  ⌊ FunctionalDomain Anaerobic ribonucleoside-triphosphate reductase-activating protein sequence (ID 388553)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:11389585 PubMed:11297442 PubMed:11427536
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Escherichia coli str. K-12 substr. MG1655 Taxon ID: 511145 16132059 NP_418658.1 (RefSeq) URP
Escherichia coli O157:H7 str. Sakai Taxon ID: 386585 15834468 NP_313241.1 (RefSeq)
Taxon ID: 543 447028977 WP_001106233.1 (RefSeq)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Anaerobic ribonucleoside-triphosphate reductase-activating protein {ECO:0000250|UniProtKB:P0A9N8} P0A9N9 NRDG_ECO57 (Swiss-Prot)
Anaerobic ribonucleoside-triphosphate reductase-activating protein {ECO:0000305} P0A9N8 NRDG_ECOLI (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 154 | Length of Functional Domain: 154

1       10        20        30        40        50        60

MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSGQPFTKAMEDQIINDLN
DTRIKRQGISLSGGDPLHPQNVPDILKLVQRIRAECPGKDIWVWTGYKLDELNAAQMQVV
DLINVLVDGKFVQDLKDPSLIWRGSSNQVVHHLR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

[anaerobic ribonucleoside-triphosphate reductase]-activating protein

+ + + + +
anaerobic ribonucleoside-triphosphate reductase (inactive)
4coi		 S-adenosyl-L-methioninate
67040		 1,5-dihydroflavin
62787		 anaerobic ribonucleoside-triphosphate reductase (active)
4coi		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319		 semiquinone
15817

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
July 15, 2014, 5:28 a.m. update family assignment evidence code CFM,ISS IEA
update superfamily assignment evidence code ISS IEA
Oct. 16, 2014, 5:32 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 5:21 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family assignment evidence code IEA CFM
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.