Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 375636)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 447178288 | WP_001255544.1 (RefSeq) | URP |
| Escherichia coli 3-073-06_S1_C1 Taxon ID: 1444055 | 652242244 | KDZ48507.1 (Genbank) | URP |
| Escherichia coli 07798 Taxon ID: 1005566 | 408213512 | EKI37997.1 (Genbank) | URP |
| Escherichia coli TW07793 Taxon ID: 869693 | 386250101 | EII96270.1 (Genbank) | URP |
| obsolete GIs = 425301126, 417286642 | |||
| Show All | |||
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPMDAGVVLRDRRLKNRDGLYVCLREGEREGWGEISPLPGFSQETWEDAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELAETLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLDKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSLLPLVDVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



