Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C2.B: Phosphomannomutase and Phosphatase Like
⌊ C2.B.2: Mannosyl-3-phosphoglycerate Phosphatase Like
⌊ Family mannosyl-3-phosphoglycerate phosphatase
⌊ FunctionalDomain mannosyl-3-phosphoglycerate phosphatase (ID 37548)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Thermus thermophilus Taxon ID: 274 | 499547541 | WP_011228324.1 (RefSeq) | |
| Thermus thermophilus HB8 Taxon ID: 300852 | 55980924 | YP_144221.1 (RefSeq) | URP |
| Thermus thermophilus HB8 Taxon ID: 300852 | 55772337 | URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | Q5SJQ3 | Q5SJQ3_THET8 (TrEMBL) |
Length of Enzyme (full-length): 259 | Length of Functional Domain: 251
MIVFTDLDGTLLDERGELGPAREALERLRALGVPVVPVTAKTRKEVEALGLEPPFIVENG
GGLYLPRDWPVRAGRPKGGYRVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVAR
LTGLSPEAARRAKAREYDETLVLCPEEVEAVLEALEAVGLEWTHGGRFYHAAKGADKGRA
AARLRALWPDPEEARFAVGLGDSLNDLPLFRAVDLAVYVGRRDPPEGVLATPAPGPEGFR
YAVERYLLPRLSRRGGSGP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



