Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family N-succinylamino acid racemase 2
⌊ FunctionalDomain N-succinylamino acid racemase 2 (ID 340)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus anthracis str. Ames Taxon ID: 198094 | 30260509 | NP_842886.1 (RefSeq) | URP |
| Bacillus anthracis Taxon ID: 1392 | 446627105 | WP_000704451.1 (RefSeq) | URP |
| Bacillus anthracis str. Sterne Taxon ID: 260799 | 49183352 | YP_026604.1 (RefSeq) | URP |
| Bacillus anthracis Taxon ID: 1392 | 816641597 | KKM34328.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 816637551 | KKM30324.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 756780631 | AJM79097.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753760185 | AJI40055.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753738894 | AJH94126.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753721210 | AJH88187.1 (Genbank) | URP |
| Bacillus anthracis str. V770-NP-1R Taxon ID: 1449979 | 753542140 | AJH97292.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753490749 | AJH54671.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753473275 | AJH51550.1 (Genbank) | URP |
| Bacillus anthracis str. Sterne Taxon ID: 260799 | 753454951 | AJH47630.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753435486 | AJH40867.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753414150 | AJH32271.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753398917 | AJH26483.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753350250 | AJG86647.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753340343 | AJG81853.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753318797 | AJG73364.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 753307374 | AJG66626.1 (Genbank) | URP |
| Bacillus anthracis str. Turkey32 Taxon ID: 1452727 | 753271846 | AJG47025.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 752324692 | AJG27284.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 751419381 | AJF88167.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 741046539 | AJA84817.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 728973996 | KHG63164.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 728972608 | KHG61788.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 728971330 | KHG60512.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721886327 | KHA45178.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721885136 | KHA44046.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721875269 | KHA34333.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721875166 | KHA34232.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721867883 | KHA27095.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721861043 | KHA20336.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721860086 | KHA19412.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721848221 | KHA07793.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721846031 | KHA05675.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721844352 | KHA04061.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721828914 | KGZ88803.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721826790 | KGZ86726.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721825659 | KGZ85627.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721812968 | KGZ73091.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721812707 | KGZ72833.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721805587 | KGZ65826.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721793556 | KGZ54508.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 721784648 | KGZ45733.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 675838017 | AIM09689.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 675832634 | AIM04307.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 674827028 | KFL79571.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 674824437 | KFL76985.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 674002417 | AIK52751.1 (Genbank) | URP |
| Bacillus anthracis str. Vollum Taxon ID: 261591 | 673994829 | AIK63212.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 673988172 | AIK57682.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 673964336 | AIK31470.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 673616351 | KFJ83001.1 (Genbank) | URP |
| Bacillus anthracis str. Carbosap Taxon ID: 1245029 | 666455596 | KEY92459.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 664791949 | AIF54803.1 (Genbank) | URP |
| Bacillus anthracis str. 95014 Taxon ID: 1437442 | 589839629 | EXJ21894.1 (Genbank) | URP |
| Bacillus anthracis str. SVA11 Taxon ID: 1392837 | 589079984 | AHK36499.1 (Genbank) | URP |
| Bacillus anthracis 52-G Taxon ID: 1412844 | 582091610 | EVU07439.1 (Genbank) | URP |
| Bacillus anthracis 9080-G Taxon ID: 1412842 | 582084750 | EVU00709.1 (Genbank) | URP |
| Bacillus anthracis 8903-G Taxon ID: 1412843 | 582078611 | EVT94845.1 (Genbank) | URP |
| Bacillus anthracis str. A16 Taxon ID: 743835 | 570716342 | AHE87679.1 (Genbank) | URP |
| Bacillus anthracis str. A16R Taxon ID: 673518 | 570710425 | AHE81764.1 (Genbank) | URP |
| Bacillus anthracis str. BF1 Taxon ID: 1213182 | 403393822 | EJY91064.1 (Genbank) | URP |
| Bacillus anthracis str. UR-1 Taxon ID: 1211117 | 401822171 | EJT21323.1 (Genbank) | URP |
| Bacillus anthracis str. H9401 Taxon ID: 768494 | 384384040 | AFH81701.1 (Genbank) | URP |
| Bacillus anthracis str. A0248 Taxon ID: 592021 | 229268401 | ACQ50038.1 (Genbank) | URP |
| Bacillus anthracis str. CDC 684 Taxon ID: 568206 | 227004373 | ACP14116.1 (Genbank) | URP |
| Bacillus anthracis Tsiankovskii-I Taxon ID: 405536 | 190561426 | EDV15398.1 (Genbank) | URP |
| Bacillus anthracis str. A0174 Taxon ID: 486622 | 172081272 | EDT66347.1 (Genbank) | URP |
| Bacillus anthracis str. A0465 Taxon ID: 486620 | 170667689 | EDT18443.1 (Genbank) | URP |
| Bacillus anthracis str. A0389 Taxon ID: 486623 | 170126156 | EDS95050.1 (Genbank) | URP |
| Bacillus anthracis str. A0442 Taxon ID: 486621 | 167530469 | EDR93184.1 (Genbank) | URP |
| Bacillus anthracis str. A0193 Taxon ID: 486619 | 167511975 | EDR87354.1 (Genbank) | URP |
| Bacillus anthracis str. A0488 Taxon ID: 486624 | 164712916 | EDR18445.1 (Genbank) | URP |
| Bacillus anthracis str. Sterne Taxon ID: 260799 | 49177279 | AAT52655.1 (Genbank) | URP |
| Bacillus anthracis str. 'Ames Ancestor' Taxon ID: 261594 | 47500754 | AAT29430.1 (Genbank) | |
| Bacillus anthracis str. Ames Taxon ID: 198094 | 30253877 | AAP24372.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 821588929 | URP | |
| Bacillus anthracis Taxon ID: 1392 | 821582934 | URP | |
| Bacillus anthracis Taxon ID: 1392 | 821576997 | URP | |
| Bacillus anthracis CZC5 Taxon ID: 1439874 | 576742908 | URP | |
| obsolete GIs = 458679067, 421638907, 421507736, 254761920, 254756102, 254740777, 254739052, 254724799, 254686723, 190567639, 177653692, 170708923, 170688357, 167640164, 167634155, 165871432, 65317762, 386734188, 229603993, 227813004, 47525606, 672925031 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | Q81ZD0 | Q81ZD0_BACAN (TrEMBL) | |
| n/a | A0A0E0VTE7 | A0A0E0VTE7_BACAN (TrEMBL) |
Length of Enzyme (full-length): 369 | Length of Functional Domain: 369
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHILKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWKNSANTLMALRSLGHLNIDWIEQPVIADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIINLDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLRE
LTVFQDIVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



