Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 33353)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | Nov. 22, 2017 |
Related Enzyme Functional Domain(s)
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Arabidopsis thaliana Taxon ID: 3702 | 42567011 | NP_193878.2 (RefSeq) | PRP URP |
Arabidopsis thaliana Taxon ID: 3702 | 332659057 | AEE84457.1 (Genbank) | PRP URP |
Arabidopsis thaliana Taxon ID: 3702 | 62752481 | AAX98488.1 (Genbank) | PRP URP |
Arabidopsis thaliana Taxon ID: 3702 | 30102526 | AAP21181.1 (Genbank) | PRP URP |
Arabidopsis thaliana Taxon ID: 3702 | 110742726 | PRP URP | |
Arabidopsis thaliana Taxon ID: 3702 | 75147182 | PRP URP | |
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
Bifunctional riboflavin kinase/FMN phosphatase | Q84MD8 | FHYRK_ARATH (Swiss-Prot) |
Length of Enzyme (full-length): 379 | Length of Functional Domain: 209
MSMSNSLKKLSSCVLIDLDGTLINTDGVVGDILRKYLCKYGKQWDGRESLKIVGKTPVEA
ATTIVEDYELPCKVDEFNSEFYPLFSAQMDKIKSLPGANRLIRHLKCHGVPVALASNSSR
ANIESKISYHEGWKECFSVIVGSDEVSKGKPSPDIFLEAAKRLKKDPADCLVIEDSVPGV
MAGKAAGTKVIAVPSLPKQTHLYTSADEVINSLLDIRLEKWGLPPFQDWIENTLPIDPWH
IGGPVIKGFGRGSKVLGIPTANLSTKDYADELVEHPSGVYFGWAGLAKRGVFKMVMSIGW
NPYFNNKEKTIEPWLLHDFTEDFYGEELRLIIVGYIRPEANFSSLESLIAKIHEDREVAE
KALDLPSYAKFKGDPYLTK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.