Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  ⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like

  ⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 308552)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 620 447062925 WP_001140181.1 (RefSeq)
Shigella boydii 965-58 Taxon ID: 766138 391276707 EIQ35472.1 (Genbank) URP
Shigella dysenteriae 155-74 Taxon ID: 766142 332097610 EGJ02587.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a I6DUN0 I6DUN0_SHIBO (TrEMBL)
n/a F3V2M4 F3V2M4_SHIDY (TrEMBL)
n/a A0A1S9K8A6 A0A1S9K8A6_SHIDY (TrEMBL)

Sequence

Length of Enzyme (full-length): 186 | Length of Functional Domain: 184

1       10        20        30        40        50        60

MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIAR
GKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSA
RDYLHIDMAASYMVGDKLEDMQAATAANVGTKVLVRTGKPVTPEAENAADWVLNSLADLP
QAIKKQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 1/2 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
53 Thr (T) side chain interacts with substrate/intermediate substrate binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
11 Asp (D) side chain nucleophile: attacks phosphate moiety of substrate to form covalent intermediate; Mg2+ ligand covalent catalysis -- reactant,
metal ligand -- binding
ICS PubMed:20050614
13 Asp (D) side chain general acid, general base; Mg2+ ligand metal ligand -- binding,
proton relay -- reactant
ICS PubMed:20050614
19 Asp (D) side chain Mg2+ ligand (via water) metal ligand -- binding ICS PubMed:20050614
53 Thr (T) side chain binds phosphate moiety of substrate substrate binding -- binding ICS PubMed:20050614
111 Lys (K) side chain binds phosphate moiety of substrate substrate binding -- binding ICS PubMed:20050614
136 Asp (D) side chain Mg2+ ligand metal ligand -- binding ICS PubMed:20050614

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3ESQ Crystal Structure Of Calcium-Bound D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.7 Zinc Ion • Calcium Ion CSA • PDB • PDBSum
2GMW Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.5 Zinc Ion CSA • PDB • PDBSum
3ESR Crystal Structure Of D,D-Heptose1.7-Bisphosphate Phosphatase From E. Coli In Complex With Calcium And Phosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion
(2 more ⇓)
CSA • PDB • PDBSum
3L1U Crystal Structure Of Calcium-Bound Gmhb From E. Coli. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion • Calcium Ion CSA • PDB • PDBSum
3L1V Crystal Structure Of Gmhb From E. Coli In Complex With Calcium And Phosphate. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion
(2 more ⇓)
CSA • PDB • PDBSum
3L8E Crystal Structure Of Apo Form Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.64 Zinc Ion • Acetic Acid CSA • PDB • PDBSum
3L8G Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli Complexed With D-Glycero-D-Manno-Heptose 1 ,7-Bisphosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 25 2.18 Selenomethionine
(4 more ⇓)
CSA • PDB • PDBSum
3L8F Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli Complexed With Magnesium And Phosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 25 1.79 Selenomethionine
(3 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
April 30, 2014, 6:20 a.m. update curation agent sbrown setDomainBoundaries.py
update domain start position 4 3
EC number assigned by UniProtKB accession ID.