Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like
⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 308141)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Shigella boydii Taxon ID: 621 | 447062927 | WP_001140183.1 (RefSeq) | URP |
| Shigella boydii 5216-82 Taxon ID: 766141 | 332095143 | EGJ00175.1 (Genbank) | URP |
| obsolete GI = 417688013 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | F3WE41 | F3WE41_9ENTR (TrEMBL) |
Length of Enzyme (full-length): 190 | Length of Functional Domain: 185
MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIAR
GKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSA
RDYLHIDMAASYMVGDKLEDMQAATAANVRTKVLVRTGKPVTPEAENAADWVLNSLADLP
QAIKKQQKPA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



