Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 300355)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 447178346 | WP_001255602.1 (RefSeq) | URP |
| Escherichia coli Taxon ID: 562 | 748034436 | KIG45944.1 (Genbank) | URP |
| Escherichia coli 5-172-05_S3_C3 Taxon ID: 1444186 | 660048611 | KEL44869.1 (Genbank) | URP |
| Escherichia coli 3-105-05_S1_C2 Taxon ID: 1444084 | 652285269 | KDZ88932.1 (Genbank) | URP |
| Escherichia coli 3-373-03_S1_C1 Taxon ID: 1444058 | 650125608 | KDU45622.1 (Genbank) | URP |
| Escherichia coli 3-373-03_S1_C3 Taxon ID: 1444112 | 650118862 | KDU39045.1 (Genbank) | URP |
| Escherichia coli 3-373-03_S1_C2 Taxon ID: 1444086 | 650057089 | KDT79443.1 (Genbank) | URP |
| Escherichia coli 1-176-05_S3_C1 Taxon ID: 1444133 | 598678908 | EYD86843.1 (Genbank) | URP |
| Escherichia coli DEC7B Taxon ID: 868166 | 378032215 | EHV94797.1 (Genbank) | URP |
| Escherichia coli E101 Taxon ID: 550685 | 371601368 | EHN90118.1 (Genbank) | URP |
| obsolete GIs = 422834576, 419176243 | |||
| Show All | |||
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQLPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



