Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 278202)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Shigella flexneri Taxon ID: 623 | 447178327 | WP_001255583.1 (RefSeq) | URP |
| Shigella flexneri Taxon ID: 623 | 721537940 | KGY81296.1 (Genbank) | URP |
| Shigella flexneri 2850-71 Taxon ID: 766158 | 391247683 | EIQ06929.1 (Genbank) | URP |
| Shigella flexneri J1713 Taxon ID: 754092 | 335574543 | EGM60861.1 (Genbank) | URP |
| Shigella flexneri K-227 Taxon ID: 766147 | 333016773 | EGK36101.1 (Genbank) | URP |
| Shigella flexneri K-272 Taxon ID: 766148 | 333002631 | EGK22191.1 (Genbank) | URP |
| obsolete GIs = 417828688, 417718157, 417713316, 420321162 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | F5NXL3 | F5NXL3_SHIFL (TrEMBL) | |
| n/a | I6BI37 | I6BI37_SHIFL (TrEMBL) |
Length of Enzyme (full-length): 320 | Length of Functional Domain: 319
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQENWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSPLPLVDADVLEQLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



