Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 278154)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli DEC14B Taxon ID: 868202 | 378218921 | EHX79190.1 (Genbank) | URP |
| Escherichia coli O104:H4 str. LB226692 Taxon ID: 1040638 | 340739730 | EGR73962.1 (Genbank) | URP |
| obsolete GIs = 419376198, 417805818, 485761689 | |||
Length of Enzyme (full-length): 279 | Length of Functional Domain: 279
MGEISPLPGFSQETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQA
ANYRAAPLCNGDPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLD
ANRAWTPLKGQQFAKYVNPDYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDF
AFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWL
TPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



