Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family N-succinylamino acid racemase 2
⌊ FunctionalDomain N-succinylamino acid racemase 2 (ID 18684)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus cereus Taxon ID: 1396 | 446627125 | WP_000704471.1 (RefSeq) | URP |
| Bacillus cereus Taxon ID: 1396 | 859613828 | KMQ34972.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 859566297 | KMP88567.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 859560884 | KMP83290.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 821634294 | KLA15268.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 821621008 | KLA02237.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 821615689 | KKZ96981.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 674832531 | KFL85022.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 674475135 | KFK75899.1 (Genbank) | URP |
| Bacillus cereus IS195 Taxon ID: 1053213 | 500381220 | EOO97580.1 (Genbank) | URP |
| Bacillus cereus IS845/00 Taxon ID: 1053214 | 500374404 | EOO91005.1 (Genbank) | URP |
| Bacillus cereus MSX-A12 Taxon ID: 1053221 | 401194815 | EJR01784.1 (Genbank) | URP |
| Bacillus cereus AND1407 Taxon ID: 1053166 | 401091181 | EJP99324.1 (Genbank) | URP |
| Bacillus cereus IS075 Taxon ID: 718220 | 401077182 | EJP85525.1 (Genbank) | URP |
| Bacillus cereus BDRD-ST26 Taxon ID: 526975 | 228646256 | EEL02472.1 (Genbank) | URP |
| Bacillus cereus AH187 Taxon ID: 405534 | 217067611 | ACJ81861.1 (Genbank) | URP |
| Bacillus cereus H3081.97 Taxon ID: 451708 | 206747498 | EDZ58888.1 (Genbank) | URP |
| Bacillus cereus NC7401 Taxon ID: 334406 | 358350974 | URP | |
| obsolete GIs = 423572683, 423375689, 423356792, 229137180, 206974258, 375282449, 217957917 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | C2RYA4 | C2RYA4_BACCE (TrEMBL) | |
| n/a | B7HT18 | B7HT18_BACC7 (TrEMBL) |
Length of Enzyme (full-length): 369 | Length of Functional Domain: 369
MKITAIHLYAIRLPLRDPFVISYGSYSHMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHTLKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPIY
QLIGGRYHEEFPVTHVLSIADPEEMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWKNSANTLTALRSLGHVNIDWIEQPVIADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIIKLDAADKVNIKLMKCGGIYPAIKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLQE
LTVFQDVVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



