Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 18631)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 447178388 | WP_001255644.1 (RefSeq) | URP |
| Escherichia coli 908525 Taxon ID: 1268995 | 553654224 | ESD72444.1 (Genbank) | URP |
| Escherichia coli 907672 Taxon ID: 1268982 | 553585326 | ESD06643.1 (Genbank) | URP |
| Escherichia coli SMS-3-5 Taxon ID: 439855 | 170520270 | ACB18448.1 (Genbank) | URP |
| Escherichia coli SMS-3-5 Taxon ID: 439855 | 226702409 | URP | |
| obsolete GIs = 167928536, 170682552 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| o-succinylbenzoate synthase {ECO:0000255|HAMAP-Rule:MF_00470} | B1LLL6 | MENC_ECOSM (Swiss-Prot) |
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPMDAGVVLRDRRLKTREGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEKGVRAVVIKPTLTG
SLDKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSPLPLVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



