Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

     ⌊ Family cis-3-hydroxy-L-proline dehydratase

  ⌊ FunctionalDomain cis-3-hydroxy-L-proline dehydratase (ID 1748139)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IES PubMed:25608448
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Labrenzia aggregata IAM 12614 Taxon ID: 384765 550544696 URP
Labrenzia aggregata IAM 12614 Taxon ID: 384765 550544695 URP
Labrenzia aggregata IAM 12614 Taxon ID: 384765 550544694 URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Cis-3-hydroxy-L-proline dehydratase {ECO:0000303|PubMed:25608448} A0NXQ8 C3HPD_LABAI (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 369 | Length of Functional Domain: 367

1       10        20        30        40        50        60

SHMKITAINVFQVDLPLREGRYSWSNGNFVEVFDSTVVEIETDEGLKGYAECCPLGSAYL
PSYALGVRSGLQELAPHLIGKDPLNIGEINRVMDAALRGHPYAKAPIDIACWDLLGKATG
QPLYTLLGGAAQDDVALYRAISQEAPEIMAKKIEGYAAEGYTKFQLKVGGDANDDINRIH
ATRSVLKKSDLLVADANTGWTRHEAARVVGAVSSLDVYIEQPCLTYEESVSIRRRTALPF
VLDEVIDGPNTLVRGIAEDAMDCINLKISKVGGLTKAKLMRDLCIAHGIPMTIEDTWGGD
IVTAAIAHLARSTPSEFTFSATDFNSYGTVDIAEGAPKRVNGRMTTSDLPGLGITPIFDV
LGEPVARYS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
220 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
243 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
167 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:11747448
195 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
220 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
243 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
Family CAR This EFD conserves 5/5 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
167 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant IME PubMed:25608448
195 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
220 Glu (E) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
243 Asp (D) side chain Metal binding ligand metal ligand -- binding ICS PubMed:25608448
267 Lys (K) side chain None -- IME PubMed:25608448

Catalyzed Reaction

cis-3-Hydroxy-L-proline dehydratase

+
cis-3-hydroxy-L-proline zwitterion
60041		 1-pyrroline-2-carboxylic acid zwitterion
39785		 water
15377

EC: 4.2.1.- | IntEnz: 4.2.1.- | Kegg: 4.2.1.- | BioCyc: 4.2.1.- | BRENDA: 4.2.1.- |

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4MGG Crystal Structure Of An Enolase (Mandelate Racemase Subgroup) From Labrenzia Aggregata Iam 12614 (Target Nysgrc-012903) With Bound Mg, Space Group P212121 Muconate Lactonizing Enzyme 3 2.2 Chloride Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 3:25 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
Aug. 10, 2015, 3:35 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
update domain end position 366 369
update name uncharacterized muconate cycloisomerase subgroup sequence cis-3-hydroxy-L-proline dehydratase
update domain start position 1 3
EC number assigned by UniProtKB accession ID.