Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ Family mdp-1
⌊ FunctionalDomain mdp-1 (ID 1448)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | CFM PubMed:11601995 |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Mus musculus Taxon ID: 10090 | 12963663 | NP_075886.1 (RefSeq) | PRP URP |
| Mus musculus Taxon ID: 10090 | 148704316 | EDL36263.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 28302279 | AAH46613.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 12656142 | AAK00763.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 78099007 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 74137486 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 56554161 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 56554160 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 56554159 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 56554158 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 56554157 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 12840787 | PRP URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Magnesium-dependent phosphatase 1 | Q9D967 | 3.1.3.- | MGDP1_MOUSE (Swiss-Prot) |
Length of Enzyme (full-length): 164 | Length of Functional Domain: 164
MTRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQS
LGVPVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVF
FDDENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKAQAGL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



