Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 1398145)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 486169844 | WP_001533103.1 (RefSeq) | URP |
| Escherichia coli O145:H25 str. 07-3858 Taxon ID: 1446583 | 651648886 | KDV30343.1 (Genbank) | URP |
| Escherichia coli O145:H28 str. 2009C-3292 Taxon ID: 1446584 | 607721407 | EZE03956.1 (Genbank) | URP |
| Escherichia coli P0302293.7 Taxon ID: 1125643 | 477119352 | END98931.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 320 | Length of Functional Domain: 320
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGGGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



