Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ Family o-succinylbenzoate synthase
⌊ FunctionalDomain o-succinylbenzoate synthase (ID 1397686)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
Family Assignment Evidence Code | IEA |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank: obsolete GI = 446222657
Length of Enzyme (full-length): 268 | Length of Functional Domain: 268
QETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRTAPLCNG
DPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQ
QFAKYVNPDYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAV
VIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTL
DLMQAQQVRRWPGSTLPVVEVDALERLL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.