Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like
⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 125154)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Mesorhizobium loti Taxon ID: 381 | 499213472 | WP_010911012.1 (RefSeq) | URP |
| Mesorhizobium loti MAFF303099 Taxon ID: 266835 | 81780089 | URP | |
| Mesorhizobium loti MAFF303099 Taxon ID: 266835 | 14023053 | URP | |
| obsolete GI = 13472307 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase | Q98I56 | 3.1.3.82 | GMHBB_RHILO (Swiss-Prot) |
Length of Enzyme (full-length): 217 | Length of Functional Domain: 185
MADKTGTPHPLTEPGVWIERIGGRVFPPHLPALFLDRDGTINVDTDYPSDPAEIVLRPQM
LPAIATANRAGIPVVVVTNQSGIARGYFGWSAFAAVNGRVLELLREEGVFVDMVLACAYH
EAGVGPLAIPDHPMRKPNPGMLVEAGKRLALDLQRSLIVGDKLADMQAGKRAGLAQGWLV
DGEAAVQPGFAIRPLRDSSELGDLLAAIETLGRDNRS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.








