Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  ⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like

  ⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 118060)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onFeb. 13, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Escherichia coli 2780750 Taxon ID: 1116015 476234614 EMW54041.1 (Genbank) URP
Escherichia coli DEC10E Taxon ID: 868184 378134806 EHW96123.1 (Genbank) URP
Escherichia coli H120 Taxon ID: 656383 323945680 EGB41729.1 (Genbank) URP

Sequence

Length of Enzyme (full-length): 147 | Length of Functional Domain: 143

1       10        20        30        40        50        60

MGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPITPE
AENAADWVLNSLADLPQAIKKQQ
KPAQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 3/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
9 Thr (T) side chain binds phosphate moiety of substrate substrate binding -- binding ICS PubMed:20050614
67 Lys (K) side chain binds phosphate moiety of substrate substrate binding -- binding ICS PubMed:20050614
92 Asp (D) side chain Mg2+ ligand metal ligand -- binding ICS PubMed:20050614

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3ESQ Crystal Structure Of Calcium-Bound D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.7 Zinc Ion • Calcium Ion CSA • PDB • PDBSum
2GMW Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.5 Zinc Ion CSA • PDB • PDBSum
3ESR Crystal Structure Of D,D-Heptose1.7-Bisphosphate Phosphatase From E. Coli In Complex With Calcium And Phosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion
(2 more ⇓)
CSA • PDB • PDBSum
3L1U Crystal Structure Of Calcium-Bound Gmhb From E. Coli. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion • Calcium Ion CSA • PDB • PDBSum
3L1V Crystal Structure Of Gmhb From E. Coli In Complex With Calcium And Phosphate. D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.95 Zinc Ion
(2 more ⇓)
CSA • PDB • PDBSum
3L8E Crystal Structure Of Apo Form Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli D,D-Heptose 1,7-Bisphosphate Phosphatase 37 1.64 Zinc Ion • Acetic Acid CSA • PDB • PDBSum
3L8G Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli Complexed With D-Glycero-D-Manno-Heptose 1 ,7-Bisphosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 25 2.18 Selenomethionine
(4 more ⇓)
CSA • PDB • PDBSum
3L8F Crystal Structure Of D,D-Heptose 1.7-Bisphosphate Phosphatase From E. Coli Complexed With Magnesium And Phosphate D,D-Heptose 1,7-Bisphosphate Phosphatase 25 1.79 Selenomethionine
(3 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Aug. 1, 2014, 5:05 p.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.