Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like
⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 115845)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli K-12 Taxon ID: 83333 | 285803759 | PRP URP | |
| Escherichia coli K-12 Taxon ID: 83333 | 285803758 | PRP URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase | P63228 | GMHBB_ECOLI (Swiss-Prot) |
Length of Enzyme (full-length): 187 | Length of Functional Domain: 185
MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIAR
GKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSA
RDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLP
QAIKKQQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.








