Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.5: Heptose Bisphosphate Phosphatase Like
⌊ FunctionalDomain C1.5.5: Heptose Bisphosphate Phosphatase Like (ID 115800)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia coli Taxon ID: 562 | 447062909 | WP_001140165.1 (RefSeq) | URP |
Escherichia coli Taxon ID: 562 | 748037731 | KIG49008.1 (Genbank) | URP |
Escherichia coli Taxon ID: 562 | 729866939 | KHH60086.1 (Genbank) | URP |
Escherichia coli 2-052-05_S4_C3 Taxon ID: 1444260 | 651715001 | KDV94629.1 (Genbank) | URP |
Escherichia coli E1520 Taxon ID: 656374 | 323935041 | EGB31414.1 (Genbank) | URP |
obsolete GI = 422768456 | |||
Show All |
Length of Enzyme (full-length): 191 | Length of Functional Domain: 185
MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIAR
GKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQLCDCRKPHPGMLLSA
RDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLP
QAIKKQQKPAQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.