Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup glucarate dehydratase

     ⌊ Family glucarate dehydratase

  ⌊ FunctionalDomain glucarate dehydratase (ID 93508)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Escherichia coli ARS4.2123 Taxon ID: 1005563 408200018 EKI25206.1 (Genbank) URP
Escherichia coli RN587/1 Taxon ID: 670899 323188795 EFZ74080.1 (Genbank) URP

Sequence

Length of Enzyme (full-length): 435 | Length of Functional Domain: 434

1       10        20        30        40        50        60

MKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGIGEAPGGEVIYQTLVEAIPMV
LGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALLDLLGQALNVPV
CELLGPGKQRDAITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQKAMNSEAVVRLA
EASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWLLDEAISLCKGL
NDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHAVMLNAVDIPLA
DPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGNPTAIDTHWIWQ
EGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHETYKRLPGGARNDAGPMQYLI
PGWTFDRKRPVFGRH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
223 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
248 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
277 Asn (N) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Lys (K) side chain abstracts alpha proton from l-stereochemistry substrates proton relay -- reactant ISS PubMed:10769114
223 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
248 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
277 Asn (N) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
301 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator ISS PubMed:10769114
327 His (H) side chain abstracts alpha proton from d-stereochemistry substates proton relay -- reactant ISS PubMed:10769114
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Lys (K) side chain abstracts alpha proton from l-idarate proton relay -- reactant IDA PubMed:11513584
223 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
248 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
277 Asn (N) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
301 Asp (D) side chain controls pKa of H385 perturbates pKa -- spectator ICS PubMed:10769114
327 His (H) side chain abstracts alpha proton from d-glucarate proton relay -- reactant IDA PubMed:11513584
329 Asn (N) side chain general acid (facilitates departure of 4-OH and stereospecific tautomerization) OR positions H339 to act as general acid proton relay -- reactant IDA PubMed:11513584

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4GYP Crystal Structure Of The Heterotetrameric Complex Of Glucd And Glucdrp From E. Coli K-12 Mg1655 Glucarate Dehydratase • Glucarate Dehydratase-Related Protein 791 2.1 Magnesium Ion
(5 more ⇓) 		CSA • PDB • PDBSum
4IL0 Crystal Structure Of Glucdrp From E. Coli K-12 Mg1655 (Efi Target Efi-506058) Glucarate Dehydratase-Related Protein 409 2.8 Citric Acid • Glycerol CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 3:22 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.