Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type I

    ⌊ Subgroup Trichodiene Synthase Like

     ⌊ Family trichodiene synthase

  ⌊ FunctionalDomain trichodiene synthase (ID 63320)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onMarch 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Fusarium sporotrichioides Taxon ID: 5514 157418059 ABV54888.1 (Genbank)
Fusarium sporotrichioides Taxon ID: 5514 157418057 ABV54887.1 (Genbank)
Fusarium sporotrichioides Taxon ID: 5514 157418055 ABV54886.1 (Genbank)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A8CZK4 A8CZK4_FUSSP (TrEMBL)

Sequence

Length of Enzyme (full-length): 147 | Length of Functional Domain: 147

1       10        20        30        40        50        60

IVGMVVYSWAKVSKECMADLSIHYTYTLVLDDSKDDPYPTMVNYFDDLQAGREQAHPWWA
LVNEHFPNVLRHFGPFCSLNLIRSTLDFFEGCWIEQYNFGGFPGSHDYPQFLRRMNGLGH
CVGASLWPKEQFNERSLFLEITSAIAQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 2/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
31 Asp (D) side chain None --
35 Asp (D) side chain None --
Subgroup CAR This EFD conserves 2/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
31 Asp (D) side chain Mg2+ ligand metal ligand -- binding ICS PubMed:11698643
32 Asp (D) side chain Forms salt bridge with R544 that facilitates active site closure activation -- spectator ICS PubMed:21562622
Family CAR This EFD conserves 4/11 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Tyr (Y) side chain Stabilizes positive charge on C7 of substrate via cation-pi interaction electrostatic stabiliser -- spectator ICS PubMed:11698643
31 Asp (D) side chain Coordinates with two divalent metal ions metal ligand -- binding ICS PubMed:11698643
32 Asp (D) side chain Forms salt bridge with R304 that facilitates active site closure activation -- spectator ICS PubMed:21562622
113 Arg (R) side chain Interacts with substrate diphosphate to trigger substrate ionization electrostatic stabiliser -- spectator ICS PubMed:11698643

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2AEL R304K Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4R)-7-Azabisabolene Trichodiene Synthase 19 2.5 Yes Magnesium Ion
(3 more ⇓) 		CSA • PDB • PDBSum
2AET R304K Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4S)-7-Azabisabolene Trichodiene Synthase 19 2.75 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2AEK R304K Trichodiene Synthase Trichodiene Synthase 19 2.9 Yes Magnesium Ion • 1,2-Ethanediol CSA • PDB • PDBSum
2PS7 Y295F Trichodiene Synthase Trichodiene Synthase 19 2.35 Yes Magnesium Ion • 1,2-Ethanediol CSA • PDB • PDBSum
2PS8 Y295F Trichodiene Synthase: Complex With Mg And Pyrophosphate Trichodiene Synthase 19 2.67 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1YYQ Y305F Trichodiene Synthase Complexed With Pyrophosphate Trichodiene Synthase 19 2.1 Yes Magnesium Ion • Pyrophosphate 2- CSA • PDB • PDBSum
1YYS Y305F Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4S)-7-Azabisabolene Trichodiene Synthase 19 2.75 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1YYR Y305F Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4R)-7-Azabisabolene Trichodiene Synthase 19 2.5 Yes Magnesium Ion
(3 more ⇓) 		CSA • PDB • PDBSum
1YJ4 Y305F Trichodiene Synthase Trichodiene Synthase 19 2.3 Yes 1,2-Ethanediol CSA • PDB • PDBSum
2PS6 N225D/S229T Trichodiene Synthase Trichodiene Synthase 18 2.6 Yes 1,2-Ethanediol CSA • PDB • PDBSum
2Q9Y Trichodiene Synthase: Complex With Mg, Inorganic Pyrophosphate, And Benzyl Triethyl Ammonium Cation Trichodiene Synthase 20 2.85 Magnesium Ion
(3 more ⇓) 		CSA • PDB • PDBSum
1JFA Trichodiene Synthase From Fusarium Sporotrichioides Trichodiene Synthase 20 2.5 1,2-Ethanediol CSA • PDB • PDBSum
1JFG Trichodiene Synthase From Fusarium Sporotrichioides Complexed With Diphosphate Trichodiene Synthase 20 2.5 Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2Q9Z Trichodiene Synthase: Complex With Inorganic Pyrophosphate Resulting From The Reaction With 2-Fluorofarnesyl Diphosphate Trichodiene Synthase 20 2.95 Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2PS5 N225D Trichodiene Synthase: Complex With Mg And Pyrophosphate Trichodiene Synthase 19 2.1 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2PS4 N225D Trichodiene Synthase Trichodiene Synthase 19 2.46 Yes Magnesium Ion • 1,2-Ethanediol CSA • PDB • PDBSum
1YYU D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4S)-7-Azabisabolene Trichodiene Synthase 19 2.95 Yes Magnesium Ion
(4 more ⇓) 		CSA • PDB • PDBSum
1KIZ D100E Trichodiene Synthase Complexed With Pyrophosphate Trichodiene Synthase 19 2.6 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1KIY D100E Trichodiene Synthase Trichodiene Synthase 19 2.4 Yes 1,2-Ethanediol CSA • PDB • PDBSum
1YYT D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, And (4R)-7-Azabisabolene Trichodiene Synthase 19 2.9 Yes Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.