Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ muconate cycloisomerase (syn) like
⌊ FunctionalDomain Uncharacterized (chloro)muconate cycloisomerase (syn) like subgroup sequence (ID 5887)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank: obsolete GI = 45514149
Length of Enzyme (full-length): 168 | Length of Functional Domain: 168
MASVYIPELEALGVELIEQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDLARDRS
VDVFSLKLCNMGGVSATQKIAAVAEASGIASYGGTMLDSTIGTSVALQLYSTVPSLPFGC
ELIGPFVLADTLSHEPLEIRDYELQVPTGVGHGMTLDEDKVRQYARVS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.