Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  Main.8: Zeta-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Zeta class GSTs (ID 57513)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Rattus norvegicus Taxon ID: 10116 157822229 NP_001102915.1 (RefSeq) PRP URP
Rattus norvegicus Taxon ID: 10116 208969735 ACI32127.1 (Genbank) PRP URP
Rattus norvegicus Taxon ID: 10116 165971039 AAI58834.1 (Genbank) PRP URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Maleylacetoacetate isomerase P57113 5.2.1.2 MAAI_RAT (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 216 | Length of Functional Domain: 209

1       10        20        30        40        50        60

MQAGKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVP
ALKIDGITIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLK
QVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDL
SPYPTISHINKALLALEAFQVSHPCRQPDTPA
ELRT
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
2CZ3 Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-2 Crystal) Maleylacetoacetate Isomerase 5 2.3 Selenomethionine CSA • PDB • PDBSum
2CZ2 Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Maleylacetoacetate Isomerase 5 1.4 Selenomethionine
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
May 3, 2014, 6:43 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 216 196
update domain start position 1 6
Aug. 16, 2016, 8:37 a.m. update domain end position 196 212
update domain start position 6 4
EC number assigned by UniProtKB accession ID.