Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.7

  ⌊ FunctionalDomain Cytosolic GST-like protein (ID 57438)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onOct. 7, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Saccharomyces cerevisiae S288c Taxon ID: 559292 6325209 NP_015277.1 (RefSeq) PRP URP
Saccharomyces cerevisiae YJM996 Taxon ID: 1294332 768900400 AJW28456.1 (Genbank) URP
Saccharomyces cerevisiae YJM990 Taxon ID: 1294330 768900130 AJW28187.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Elongation factor 1-gamma 1 P29547 EF1G1_YEAST (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 415 | Length of Functional Domain: 415

1       10        20        30        40        50        60

MSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKL
TEAMAINYYLVKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKG
GAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTE
WRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQKKKEKKAPAAAPAASKKKEEA
KPAATETETSSKKPKHPLELLGKSTFVLDDWKRKYSNEDTRPVALPWFWEHYNPEEYSLW
KVTYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDY
VPAFDVAPDWESYDYAKLDPTNDDDKEFINNMWAWDKPVSVNGEPKEIVDGKVLK
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
1NHY Crystal Structure Of The Gst-Like Domain Of Elongation Factor 1-Gamma From Saccharomyces Cerevisiae. Elongation Factor 1-Gamma 1 5 3.0 Selenomethionine • Sulfate Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:43 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 200 198
update domain start position 1 5
Aug. 16, 2016, 8:37 a.m. update domain end position 198 415
update domain start position 5 1
EC number assigned by UniProtKB accession ID.