Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.2: Nu-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Nu class GSTs (ID 57241)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Dictyostelium discoideum AX4 Taxon ID: 352472 66800019 XP_628935.1 (RefSeq)
Dictyostelium discoideum AX4 Taxon ID: 352472 60462298 EAL60523.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q54B85 Q54B85_DICDI (TrEMBL)

Sequence

Length of Enzyme (full-length): 275 | Length of Functional Domain: 220

1       10        20        30        40        50        60

MNCINNYNNNNNNNNNNNKIMIPDLKNNDTGSSADDGRSEGVADYQVYGFYTSCSFKVYF
MFEELNIPYQTCLVNIRSGEHFKGEFAEMSPNNKIPMLIDNTYSVDSGDDDEPLKIFESG
AILLYLAEKYQKFLPPLSKPKERCQVQQWLSWQISEMQPALTSYVYYFMMAPEPVAFGME
KADQDLHKILKVLDKRLDDGRKYICNEFSIADIACFGFGSYFNLNVFKGWNKYENVVRWV
NTMSSRPSISKLLPIVEQTLRVRKLKRLDNQELVL
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:42 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 275 246
update domain start position 1 45
Aug. 16, 2016, 8:36 a.m. update domain end position 246 261
update domain start position 45 42
EC number assigned by UniProtKB accession ID.