Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  Main.2: Nu-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Nu class GSTs (ID 56622)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onOct. 14, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Shigella flexneri 2a str. 301 Taxon ID: 198214 24114297 NP_708807.1 (RefSeq)
Shigella flexneri Taxon ID: 623 446050700 WP_000128555.1 (RefSeq) URP
Shigella flexneri 2a str. 301 Taxon ID: 198214 24053454 AAN44514.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A0H2V232 A0A0H2V232_SHIFL (TrEMBL)

Sequence

Length of Enzyme (full-length): 304 | Length of Functional Domain: 223

1       10        20        30        40        50        60

MTCYTASTLPLRRQLTMTDNTYQPAKVWTWDKSAGGAFANINRPFSGPTHEKTLPVGKHP
LQLYSLGTPNGQKVTIMLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPAL
RDHTHNPPIRVFESGSILLYLAEKFGYFLPQDLAKRTETLNWLFWLQGAAPFLGGGFGHF
YHYAPVKIEYAINRFTMEAKRLLDVLDKQLAQHKFVAGNEYTIADMAIWPWFGNVVLGGV
YDAAEFLDAGSYKHVQRWAKEVGERPAVKRGRIVNRTNGP
LNEQLHERHDASDFETNTED
KRQG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3C8E Crystal Structure Analysis Of Yghu From E. Coli Yghu, Glutathione S-Transferase Homologue 41 1.5 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
May 3, 2014, 6:41 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 304 265
Aug. 16, 2016, 8:35 a.m. update domain end position 265 280
update domain start position 61 58
EC number assigned by UniProtKB accession ID.