Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ Family deoxy-d-mannose-octulosonate 8-phosphate phosphatase
⌊ FunctionalDomain deoxy-d-mannose-octulosonate 8-phosphate phosphatase (ID 470612)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
Family Assignment Evidence Code | IEA |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Shigella flexneri Taxon ID: 623 | 445952158 | WP_000030013.1 (RefSeq) | URP |
Shigella flexneri Taxon ID: 623 | 721537149 | KGY80505.1 (Genbank) | URP |
Shigella flexneri K-1770 Taxon ID: 766153 | 391247610 | EIQ06857.1 (Genbank) | URP |
Shigella flexneri VA-6 Taxon ID: 766145 | 332998840 | EGK18436.1 (Genbank) | URP |
obsolete GIs = 420333120, 417709289 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | F5N7M1 | F5N7M1_SHIFL (TrEMBL) |
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASLATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLIDCPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.