Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ Family deoxy-d-mannose-octulosonate 8-phosphate phosphatase
⌊ FunctionalDomain deoxy-d-mannose-octulosonate 8-phosphate phosphatase (ID 467370)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 445952157 | WP_000030012.1 (RefSeq) | URP |
| Escherichia coli DEC11E Taxon ID: 868190 | 378156246 | EHX17298.1 (Genbank) | URP |
| Escherichia coli DEC11D Taxon ID: 868189 | 378145945 | EHX07100.1 (Genbank) | URP |
| obsolete GIs = 419313220, 419308185 | |||
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASLATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENV
AYIGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



