Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  ⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like

  ⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 443744)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 1386 446610017 WP_000687363.1 (RefSeq)
Bacillus bombysepticus str. Wang Taxon ID: 1330043 612488856 AHX17524.1 (Genbank) URP
Bacillus cereus BAG4O-1 Taxon ID: 1053185 401121639 EJQ29428.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A0E8TNH4 A0A0E8TNH4_STREE (TrEMBL)
n/a A0A135WB99 A0A135WB99_9BACI (TrEMBL)
n/a W8Y7M7 W8Y7M7_BACTU (TrEMBL)
Show All

Sequence

Length of Enzyme (full-length): 264 | Length of Functional Domain: 264

1       10        20        30        40        50        60

MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEM
PRIASEWNRVFQQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIG
STTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNHMIK
VGDTVSDMKEGRNAGMWTVGVILGSSELGLTEEEVENMDSVELREKIEVVRNRFVENGAH
FTIETMQELESVMEHIEKQELIIS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 2/2 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
9 Asp (D) side chain nucleophile: forms covalent intermediate covalent catalysis -- reactant ISS
123 Thr (T) side chain interacts with substrate/intermediate substrate binding -- binding ISS
Subgroup CAR This EFD conserves 2/2 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
9 Asp (D) side chain Mg2+ ligand, nucleophile: attacks phosphate moiety of intermediate to form covalent intermediate covalent catalysis -- reactant,
metal ligand -- binding 		ICS PubMed:12081483
157 Arg (R) side chain None -- ICS PubMed:10956028 PubMed:12081483

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2IOF Crystal Structure Of Phosphonoacetaldehyde Hydrolase With Sodium Borohydride-Reduced Substrate Intermediate Phosphonoacetaldehyde Hydrolase • Phosphonoacetaldehyde Hydrolase 37 2.5 N~6~-Ethyl-L-Lysine
(2 more ⇓) 		CSA • PDB • PDBSum
2IOH Crystal Structure Of Phosphonoacetaldehyde Hydrolase With A K53R Mutation Phosphonoacetaldehyde Hydrolase 33 2.9 Yes Phosphate Ion • Magnesium Ion CSA • PDB • PDBSum
1RQN Phosphonoacetaldehyde Hydrolase Complexed With Magnesium Phosphonoacetaldehyde Hydrolase 33 2.8 Magnesium Ion CSA • PDB • PDBSum
1RQL Crystal Structure Of Phosponoacetaldehyde Hydrolase Complexed With Magnesium And The Inhibitor Vinyl Sulfonate Phosphonoacetaldehyde Hydrolase 33 2.4 Magnesium Ion • Vinylsulphonic Acid CSA • PDB • PDBSum
1SWW Crystal Structure Of The Phosphonoacetaldehyde Hydrolase D12A Mutant Complexed With Magnesium And Substrate Phosphonoacetaldehyde Phosphonoacetaldehyde Hydrolase 33 2.3 Magnesium Ion • Phosphonoacetaldehyde CSA • PDB • PDBSum
1SWV Crystal Structure Of The D12A Mutant Of Phosphonoacetaldehyde Hydrolase Complexed With Magnesium Phosphonoacetaldehyde Hydrolase 33 2.3 Yes Magnesium Ion CSA • PDB • PDBSum
1FEZ The Crystal Structure Of Bacillus Cereus Phosphonoacetaldehyde Hydrolase Complexed With Tungstate, A Product Analog Phosphonoacetaldehyde Hydrolase 31 3.0 Tungstate(Vi)Ion • Magnesium Ion CSA • PDB • PDBSum
1RDF G50P Mutant Of Phosphonoacetaldehyde Hydrolase In Complex With Substrate Analogue Vinyl Sulfonate Phosphonoacetaldehyde Hydrolase 28 2.8 Yes Magnesium Ion • Ethanesulfonic Acid CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 2:10 p.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.