Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 443744)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 1386 | 446610017 | WP_000687363.1 (RefSeq) | |
| Bacillus bombysepticus str. Wang Taxon ID: 1330043 | 612488856 | AHX17524.1 (Genbank) | URP |
| Bacillus cereus BAG4O-1 Taxon ID: 1053185 | 401121639 | EJQ29428.1 (Genbank) | URP |
| Bacillus cereus BAG3O-2 Taxon ID: 1053182 | 401097805 | EJQ05827.1 (Genbank) | URP |
| Streptococcus pneumoniae Taxon ID: 1313 | 814307214 | URP | |
| Streptococcus pneumoniae Taxon ID: 1313 | 806769391 | URP | |
| Bacillus thuringiensis DB27 Taxon ID: 1431339 | 589238495 | URP | |
| obsolete GIs = 423429333, 423414885 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0E8TNH4 | A0A0E8TNH4_STREE (TrEMBL) | |
| n/a | A0A135WB99 | A0A135WB99_9BACI (TrEMBL) | |
| n/a | W8Y7M7 | W8Y7M7_BACTU (TrEMBL) | |
| n/a | J7WC34 | J7WC34_BACCE (TrEMBL) | |
| n/a | A0A023P4H4 | A0A023P4H4_9BACI (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 264 | Length of Functional Domain: 264
MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEM
PRIASEWNRVFQQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIG
STTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNHMIK
VGDTVSDMKEGRNAGMWTVGVILGSSELGLTEEEVENMDSVELREKIEVVRNRFVENGAH
FTIETMQELESVMEHIEKQELIIS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



