Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ FunctionalDomain Uncharacterised Radical SAM sequence (ID 440883)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Jan. 1, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli DEC6D Taxon ID: 868163 | 378012331 | EHV75263.1 (Genbank) | URP |
| Escherichia coli ISC41 Taxon ID: 1432559 | 576029509 | URP | |
| obsolete GIs = 419158242, 485802022 | |||
Length of Enzyme (full-length): 131 | Length of Functional Domain: 131
MIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWS
DDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKG
ILEQYGHKVMF
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



