Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ FunctionalDomain uncharacterized Organic radical-activating enzymes subgroup sequence (ID 440867)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 543 | 490998335 | WP_004860059.1 (RefSeq) | |
| Raoultella ornithinolytica Taxon ID: 54291 | 763450901 | KIZ43645.1 (Genbank) | URP |
| Escherichia coli 2-156-04_S1_C2 Taxon ID: 1444067 | 651841052 | KDX15229.1 (Genbank) | URP |
| Escherichia coli 2-156-04_S1_C1 Taxon ID: 1444039 | 651716120 | KDV95712.1 (Genbank) | URP |
| Raoultella ornithinolytica B6 Taxon ID: 1286170 | 480476764 | AGJ86782.1 (Genbank) | URP |
| Klebsiella oxytoca 10-5246 Taxon ID: 883121 | 376398165 | EHT10792.1 (Genbank) | URP |
| obsolete GIs = 423119511, 481849894 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A181XTA3 | A0A181XTA3_KLEOX (TrEMBL) |
Length of Enzyme (full-length): 246 | Length of Functional Domain: 245
MSTIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGTEVTVESLMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACRKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFARYLSNKNIKVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVHPPKKETMDRVKGILEQY
GHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



