Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ FunctionalDomain uncharacterized Organic radical-activating enzymes subgroup sequence (ID 440866)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Klebsiella oxytoca Taxon ID: 571 | 838860099 | KLY41994.1 (Genbank) | URP |
Klebsiella oxytoca MGH 27 Taxon ID: 1328428 | 583722643 | EWF84604.1 (Genbank) | URP |
Klebsiella oxytoca MGH 41 Taxon ID: 1328430 | 583709331 | EWF71438.1 (Genbank) | URP |
Klebsiella oxytoca 10-5250 Taxon ID: 883125 | 376393707 | EHT06363.1 (Genbank) | URP |
Klebsiella oxytoca 10-5242 Taxon ID: 883117 | 376389833 | EHT02522.1 (Genbank) | URP |
obsolete GIs = 423128351, 423102250, 490232592 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | A0A181X4D2 | A0A181X4D2_KLEOX (TrEMBL) | |
n/a | H3N9P3 | H3N9P3_9ENTR (TrEMBL) |
Length of Enzyme (full-length): 276 | Length of Functional Domain: 245
MDNSQNRLDIAFELCIYIGPGWAKFGDITAMSTIGRIHSFESCGTVDGPGIRFITFFQGC
LMRCLYCHNRDTWDTHGGKEITVEELMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRD
WFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRT
LEFARYLSNKNINVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKW
VAMGEEYKLDGVHPPKKETMERVKGILEQYGHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.