Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ FunctionalDomain uncharacterized Organic radical-activating enzymes subgroup sequence (ID 440865)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Taxon ID: 570 | 490202213 | WP_004100682.1 (RefSeq) | |
Klebsiella oxytoca Taxon ID: 571 | 838847895 | KLY29873.1 (Genbank) | URP |
Klebsiella oxytoca Taxon ID: 571 | 838832857 | KLY14957.1 (Genbank) | URP |
Klebsiella oxytoca Taxon ID: 571 | 828947112 | AKL22316.1 (Genbank) | URP |
Klebsiella oxytoca Taxon ID: 571 | 828928904 | AKL05392.1 (Genbank) | URP |
Klebsiella oxytoca G54 Taxon ID: 1409787 | 601468862 | EYT11012.1 (Genbank) | URP |
Klebsiella oxytoca OK-1 Taxon ID: 1256995 | 577053335 | EUC91099.1 (Genbank) | URP |
Klebsiella oxytoca KA-2 Taxon ID: 1256996 | 577046476 | EUC85017.1 (Genbank) | URP |
Klebsiella oxytoca MGH 28 Taxon ID: 1328429 | 555161612 | ESN04305.1 (Genbank) | URP |
Klebsiella oxytoca MGH 42 Taxon ID: 1328431 | 555132693 | ESM75505.1 (Genbank) | URP |
Klebsiella oxytoca 10-5245 Taxon ID: 883120 | 376388226 | EHT00926.1 (Genbank) | URP |
Klebsiella oxytoca 10-5243 Taxon ID: 883118 | 376387809 | EHT00512.1 (Genbank) | URP |
obsolete GIs = 423113540, 423107597 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | A0A1E9Z4H0 | A0A1E9Z4H0_9ENTR (TrEMBL) | |
n/a | A0A181XQN2 | A0A181XQN2_KLEOX (TrEMBL) |
Length of Enzyme (full-length): 246 | Length of Functional Domain: 245
MSTIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEITVEELMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFARYLSNKNIKVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVHPPKKETMERVKGILEQY
GHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.