Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ FunctionalDomain uncharacterized Organic radical-activating enzymes subgroup sequence (ID 440214)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 445990119 | WP_000067974.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. AB198 Taxon ID: 1331043 | 575532989 | ETX33550.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. 19945 Taxon ID: 1079470 | 554166564 | ESG06110.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. 13036 Taxon ID: 1079471 | 553446818 | ESB71751.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum/Pullorum str. CDC1983-67 Taxon ID: 1225522 | 537374220 | AGU64863.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. S06004 Taxon ID: 1298917 | 529191574 | AGS63323.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 Taxon ID: 1081093 | 357206318 | AET54364.1 (Genbank) | URP |
| obsolete GIs = 537437274, 529220131, 378955707 | |||
| Show All | |||
Length of Enzyme (full-length): 265 | Length of Functional Domain: 245
MSNLTNCITNESVAVTADKKPVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRD
TWDTHGGKEITVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIH
TCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFTQYLSKKN
VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDG
VKPPKKETMERVKGILEQYGHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



