Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup 7-carboxy-7-deazaguanine synthase like
⌊ Family 7-carboxy-7-deazaguanine synthase, Cx14CxxC type
⌊ FunctionalDomain uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence (ID 436540)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Burkholderia cenocepacia Taxon ID: 95486 | 499865746 | WP_011546480.1 (RefSeq) | URP |
| Burkholderia cenocepacia Taxon ID: 95486 | 721501639 | KGY45134.1 (Genbank) | URP |
| Burkholderia cenocepacia KC-01 Taxon ID: 1396830 | 557795274 | ESS38971.1 (Genbank) | URP |
| Burkholderia cenocepacia MC0-3 Taxon ID: 406425 | 169817709 | ACA92292.1 (Genbank) | URP |
| Burkholderia cenocepacia HI2424 Taxon ID: 331272 | 116649225 | ABK09866.1 (Genbank) | URP |
| Burkholderia cenocepacia AU 1054 Taxon ID: 331271 | 105894238 | ABF77403.1 (Genbank) | URP |
| obsolete GIs = 116691136, 107024049, 170734467 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1U9MKZ8 | A0A1U9MKZ8_9BURK (TrEMBL) | |
| n/a | V4ZZQ2 | V4ZZQ2_9BURK (TrEMBL) | |
| n/a | B1K0I7 | B1K0I7_BURCC (TrEMBL) | |
| n/a | A0A0H2XTF6 | A0A0H2XTF6_BURCA (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 210 | Length of Functional Domain: 210
MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN
GGKFKDAAALVATIAGLWPEGEANRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS
LPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEYFLVQPMDGPSR
DLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



