Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup SPASM/twitch domain containing
⌊ main SPASM domain-containing
⌊ cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 432065)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Dec. 10, 2016 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus subsp. aureus CIG1524 Taxon ID: 931454 | 377756115 | EHT80012.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus CIG290 Taxon ID: 931451 | 377749574 | EHT73522.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21194 Taxon ID: 904727 | 365245546 | EHM86178.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21202 Taxon ID: 904732 | 365171765 | EHM62535.1 (Genbank) | URP |
| obsolete GIs = 418282005, 418992257, 418887502, 418307551, 447046506 | |||
| Show All | |||
Length of Enzyme (full-length): 309 | Length of Functional Domain: 309
MPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLN
QIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQ
IDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVV
TKDEMLTMIEQHFEINPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSS
DGKFYGCLFATVDGFNVKTFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQRK
KINMNYIGG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



