Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup SPASM/twitch domain containing
⌊ main SPASM domain-containing
⌊ cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 431993)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Dec. 10, 2016 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus subsp. aureus SA268 Taxon ID: 1368166 | 670940781 | AII56736.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus SA957 Taxon ID: 1201010 | 545582511 | AGW34593.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus M013 Taxon ID: 1118959 | 359831240 | AEV79218.1 (Genbank) | URP |
| obsolete GIs = 545635622, 447046508, 379021931 | |||
Length of Enzyme (full-length): 309 | Length of Functional Domain: 309
MPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLNVLIAKLN
QIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQ
IDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVV
TKDEMLTMIEEHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSS
DGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQRK
KINMNYIGG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



