Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup 7-carboxy-7-deazaguanine synthase like
⌊ Family 7-carboxy-7-deazaguanine synthase, Cx14CxxC type
⌊ FunctionalDomain uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence (ID 422555)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 32008 | 493807662 | WP_006755430.1 (RefSeq) | |
| Burkholderia ambifaria AMMD Taxon ID: 339670 | 773028237 | AJY22143.1 (Genbank) | URP |
| Burkholderia sp. A9 Taxon ID: 1365108 | 733385931 | KHK60874.1 (Genbank) | URP |
| Burkholderia cepacia GG4 Taxon ID: 1009846 | 402246315 | AFQ46769.1 (Genbank) | URP |
| Burkholderia ambifaria MC40-6 Taxon ID: 398577 | 171994613 | ACB65532.1 (Genbank) | URP |
| Burkholderia ambifaria MEX-5 Taxon ID: 396597 | 171095341 | EDT40322.1 (Genbank) | URP |
| Burkholderia ambifaria IOP40-10 Taxon ID: 396596 | 170131652 | EDT00208.1 (Genbank) | URP |
| Burkholderia ambifaria AMMD Taxon ID: 339670 | 115283212 | ABI88729.1 (Genbank) | URP |
| obsolete GIs = 171319449, 170703437, 402565118, 172062096, 115353224 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0B1YQ61 | A0A0B1YQ61_9BURK (TrEMBL) | |
| n/a | Q0BAU4 | Q0BAU4_BURCM (TrEMBL) | |
| n/a | B1T7Z2 | B1T7Z2_9BURK (TrEMBL) | |
| n/a | J7J346 | J7J346_BURCE (TrEMBL) | |
| n/a | B1FQG2 | B1FQG2_9BURK (TrEMBL) | |
| n/a | B1YPW8 | B1YPW8_BURA4 (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 210 | Length of Functional Domain: 210
MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN
GGKFKDAEALVATIAGLWPDGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS
LPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSR
DLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



